PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 323aa    MW: 35773 Da    PI: 7.6144
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30912.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.83.1e-4053113262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  KHN30912.1  53 HDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 113
                 6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2847107IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3354111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18957111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGLSSLHVCM DSSDHWLQGT IHEESGMDSS SSPSGDMLTC SRPMIERRLR PPHDQALKCP  60
RCDSTHTKFC YYNNYSLSQP RYFCKTCRRY WTKGGTLRNI PVGGGCRKNK KVSAKKSNDH  120
QLVNNNNISQ TRPPHHHHPK DLQLSSFPDV QFSHLSNLLG TNANPSFMEG KYGIGMIENP  180
RPIDFMMESK LEGIIGSGHV GLGDMNGATT HQNGLPPNLY HHGLSAFGGM SMSLDHGNNS  240
DNNGANRYLM DSCQRLMLPY DVSNEDHNAQ IDVKPNPKQL LSLEWQDQGC SDAGKDSFGY  300
LNGPGSWTGM MNGYGSSTTH PLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572640.0DQ857264.1 Glycine max Dof14 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523081.10.0PREDICTED: dof zinc finger protein DOF5.6
SwissprotQ9FM032e-56DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A0B2RGI00.0A0A0B2RGI0_GLYSO; Dof zinc finger protein DOF5.6
STRINGGLYMA04G35650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.15e-54Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]